Labrador gun dogs for sale. We are always adding new dogs.
Labrador gun dogs for sale . £1500. A place to brag about your hunting dogs and post photos and share stories with other Gun Dog enthusiast. Spell: Female Chocolate Labrador: Spell Just Turned 3 years old in February of 2025. Basic Obedience2. Harris kennels is committed to breeding the very best gun dog in the country. Our started English Springer Spaniels and Labrador Retrievers show the good looks, excellent temperament, remarkable intelligence, style, and stamina you would expect from their pedigrees. All of our German Shorthair Pointers are bred from some of the purest blood lines and proven hunting dogs. THE PUPPIES. Our training and breeding programs produce stylish retrievers that are exciting to watch in the field and a pleasure to have as hunting partners and family companions. Mar 8, 2025 · Have a hunting dog for sale? List it here for Free. She is a Fully Trained Gun Dog. Gundogs for sale. Hunting lab breeders Mar 7, 2025 · At Prince's Quality Gun Dogs, we not only breed some of the highest quality GSP hunting dogs, but also great companions. Click any buttons below to instantly remove any one of the choosen filters. GunDogsDirect: Easy buy/sell platform for gundogs. All our dogs are shot over regularly and work picking-up 4 to 5 times per week throughout the shooting season. Posted on 03/30/2025 - - Last updated on 03/30/2025. Fox Red Labrador Bitch. Find 37 Gundog Labrador Retriever puppies for sale on Pets4Homes - UK’s largest pet classifieds site to buy and sell puppies near you. Home Dogs For Sale Login "We purchased Digby , a twelve month old black Labrador from Bournepark Gundogs in August, Eric Burchell continued with Digby's training in the Netherlands until the end of September, so we could arrange for Digby's transport back to the UK, which was proving difficult to do due to the Covid-19 travel isolation restrictions. ONLINE EDUCATION To prepare a fully trained gundog, we start from the breeding and then the foundation program and then move onto the shooting field. Snook Family Sporting Dogs & Training Penn Valley - California Hunting Dog Breeds Raised: English Pointer, Labrador Retriever We are a small family run business based in the South West of Devon, in a little town called Chudleigh. Showing 50 of 140 total records. AKC TITLED, ALL CERTS. Finished labs are fully trained to hunt waterfowl, hunt upland bird and are adjusted to living in the home. Find 78 Gundog Puppies for sale on Pets4Homes - UK’s largest pet classifieds site to buy and sell puppies near you. " 5 Males / 3 Females; KC Registered; Age: 9 weeks; Ready to leave: Now Our beautiful yellow Labrador Retriever has a litter of 8 Puppies (just one male puppy available now - a very handsome, cuddly and intelligent pup, he was the first boy to be chosen but unfortunately the new family are now unable to take him due to a change in their circumstances) from a family line of working dogs. www. in the early 1980's. YELLOW STUD. Marhystin puppies can be found in Aspen, Colorado as Search and Rescue dogs, all over Europe as Medical Alert dogs, Drug Detection dogs, and all over the USA as working dogs and family pets, we are very proud of our lineage of dogs. Aug 23, 2023 · Hightest offers well trained gun dog Labrador Retrievers as well as obedience trained labs as wonderful family dogs. Labrador Puppies For Sale 4 days ago · Wild bird hunting has been a part of our family heritage for over 60 years and hunting quality dogs has become a way of life. If that is your requirement – we can help. We have a range of options for all requirements, from puppies to part and fully trained Gundogs. Become a Member Trained Dogs & Pedigree Puppies For Sale We are breeders of Cocker Spaniels and Labradors with excellent working lineage. Edmonds Xtreme Gun Dogs strives to produce and train high quality gun dogs that will excel in the field, the duck blind and as your family companion. 1102. We have 1 yellow male, 1 black male and 1 yellow female available. Labrador Retriever Hunting Dog For Sale. We also offer stud service. These exceptional British Labs perform over and over again as the very best in their class. Results: 1 to 12 of 25 Jul 18, 2022 · We want dogs who have great social skills, good drive and style in the field, and a true off-switch when not working. Based in Perthshire, we train and breed dogs to suit specific living arrangements, as well as working dogs to perform in the shooting field. co. The Gentle Dog: Mild-mannered and intelligent, for therapy, comfort and service. Showing 30 of 30 total records. 1. If you want a pup for waterfowl, upland, service dog, or hunt test dog, we can bring you the best of both worlds while still being the beloved family pet everyone wants. We also sell 100%, protein-rich, additive, preservative and 100% grain-free dog, veterinary approved dog food, made here in the UK. We offer three different levels of started hunting dogs to meet your requirements. The path to your next gundog starts here. As owner of Wildrose Kennels, Robert Milner brought the British Labrador program to the U. We breed & train British labs from field trial lines, some imported directly from the United Kingdom. At Prince's Quality Gun Dogs, we not Browse Gun Dogs for Sale from our community of shooting enthusiasts on the UK’s #1 gun marketplace. We produce top quality, trainable gun dogs for both the shooting field and as active, loyal family pets. The Classic Dog: Working dogs in the classic British tradition, they are calm and biddable, dependable partners in the field and at home. Gun Dogs Online - Hunting Dogs For Sale in our Classified Area. Dec 25, 2024 · All of our dogs are house dogs. Labrador Retriever's for sale. Any pup which is bought from us and needs training can be brought back. Labrador Retriever Hunting Dogs and Puppies for sale. Code 3 Retrievers provides Labrador retriever training, AKC and NAHRA hunt test training, professional gun dog training, and Labrador retriever puppies for sale. Gundogs are vital aspects to a shoot day, most commonly labradors and spaniels. This level of training competence is typically achieved in four to six months, depending upon the dog’s ability and background. Dog Supplies, Training Articles, Dog Training Products for hunting dogs. Okehampton, UK. Sep 28, 2024 · Have a hunting dog for sale? List it here for Free. We occasionally offer well trained Gun Dogs for sale, from the Basic training level, through Transition and Finished levels of work. Trained Labrador Retrievers For Sale. Gun Dog UK classifieds for the upland bird hunter and wetland waterfowl hunter. Based in the Mid-Wales countryside (the central base for Three Valleys and Long Mountain Shoot), top quality gundogs are bred and trained for this demanding vocation. We make the buying and selling of working dogs online even easier, safer and convenient All Categories Gundog Puppies For Sale Gundogs For Stud Trained Gundogs For Sale Other Working Dogs For Sale Due to the amount of gundogs required on a first class commercial pheasant shoot, Threevalleys gundogs was formed. Walnut Ridge Gun Dogs Pulaski - Tennessee Hunting Dog Breeds Raised: American Brittany, Boykin Spaniel, English Setter, German Shorthaired Pointer, German Wirehaired Pointer, Labrador Retriever Find 10 Trained gundog Labrador Retriever puppies for sale on Pets4Homes - UK’s largest pet classifieds site to buy and sell puppies near you. The litter of pups have been kept in the house from birth, and are already accustomed to household visitors, noises and general comings and goings. For more information, Bournepark Hamish, Yellow labrador dog by FTCH Mitforton Oscar of Leadburn x daughter of OFTW Quarnford Grouse of Rufriver, date of birth 22-09-2022, Handsome dog with drive and style, great retriever and excellent marker both on water and land, good with live and cold game. TRAINED LABRADOR FOR SALE. “My goal is to deliver a finished retriever that a person would want to hunt and live with,” John says. millershookgundogs. Our classified ads have a variety of retrievers for sale from started labs to finished retrievers that will make excellent gun dogs, hunting dogs or bird dogs. Welcome to Livingston Gundogs! Importing, breeding and training first generation field bred British Labrador Retrievers from champion UK lines since 2015. Welcome to Gun Dog Trader – The online place to buy and sell gun dogs. Showing 50 of 134 total records. A Labrador being worked hard during a hunting trip will require 2,000 to 5,000 calories per day! Experts in hunting dog nutrition recommend feeding dogs a diet that has at least 25% protein and around 20% crude fat. " Apr 3, 2020 · Have a hunting dog for sale? List it here for Free. We also offer started dogs and pointing lab pups. You can find more information about our Current Litters and Upcoming Breedings on our Puppies pages. We are always adding new dogs. She has been living in the house. She is also a finished HOUSE Companion. 8mths old, KC reg from health More Than a Kennel The Blue Cypress Experience … Our Dogs Shop Now Scroll Down Blue Cypress Kennels has become the epicenter of impeccable dog breeding programs. My Labradors, all sired by Drakeshead dogs, are the perfect combination of talented working dogs and mannerly house dogs. 308-530-2964 | info@duckdawg. Workingman Gundogs strives to provide the blue-collar working man with affordable, high-performing pups with the drive and desire to perform on the field. Aug 21, 2011 · Premium 8 month old duck hunting dogs for sale. Showing 50 of 73 total records. Our #1 goal is connecting buyers and breeders for the best possible puppy buying experience. Mar 8, 2025 · Have a hunting dog for sale? List it here for Free. Tibea Gundogs main approach is to provide quality, well-trained dogs for the gun, however the British Labrador has proved to be the chosen dog, because of its calm demeanor and work ethic, as a service dog or assistance support dog including PTSD. highly-motivated Labrador Retrievers that can be successful as hunting Buy & Sell Gun Dog Puppies Online with Gun Dog Trader - The UK's Fastest Growing Platform for the Buying and Selling of Gun Dog Puppies Online Other Working Dogs At Prince's Quality Gun Dogs, we not only breed some of the highest quality GSP hunting dogs, but also great companions. Three dogs remain of the litter, 2 black and one handsome yellow. Simple, Fast, Affordable Kennel websites that are easy to use and maintain. In the market for a Trained Retriever? We occasionally offer labs for sale that have been through one of our gun dog training programs. Proven Performance. Learn more about our breeding program here. That is why they are chosen for excellence in genetics and performance. We breed for intelligence, bird finding ability, early natural ability, a pleasing appearance and the desire to please. Whether you buy a puppy, a trained Gun Dog or bring your dog in for training, we are here to provide you with a fabulous Gun Dog that meets your needs. British Labrador Retrievers. Showing 17 of 17 total records. Training near to completion. KC reg 8 mths Yellow Labrador dog. Finished Hunting Dog Basic Obedience - As the name suggests, dogs Mordor Gundog is a training school for family pet dogs, gundogs and their owners. Puppies for sale listings from the best gun dog breeders, trainers and kennels. Dog Training Dog Breeding Premiere gun dog breeders of Labradors. Find 9 Trained gundog Labrador Retriever puppies for sale on Pets4Homes - UK’s largest pet classifieds site to buy and sell puppies near you. View reviews of thousands of breeders listing hundreds of puppy for sale ads in your local area. Lovely yellow Labrador dog. Apr 3, 2020 · Have a hunting dog for sale? List it here for Free. All our dogs undergo full health screening. We breed and sell Labrador retrievers to be exceptional hunting dogs and family members. TRAINED LABRADOR RETRIEVERS. GunDogsDirect: Easy buy/sell platform for Labradors Puppies gundogs. Our kennel is also actively involved in UKC Hunt Tests, and nearly all of our adult dogs carry advanced hunt test titles including UH, SHR, HR, HRCH, and MH. We want to see the dog’s ability to sit behind the line and quietly watch other dogs work without making noise or creeping. "Champions in The Field and The Home. Find the best hunting dog puppies for sale from the top gun dog breeders. Retrievers - Labrador Retriever - Finished Dogs. Global Business Insight Awards – Cuckavalda Gundogs was selected as Most Trusted in Dog Breeding Service for the UK . £1600. These dogs are from top quality breeding and have been molded since puppy-hood for their future job as a gundog and family companion. Garden & Gun Magazine Blue Cypress Kennels has set the … Home Read More » Started & Finished Labradors For Sale. Feb 7, 2025 · Retrievers - Labrador Retriever - Puppies for Sale - NORTH CAROLINA. 3946. Find puppies for sale, gun dogs for sale, trained hunting dogs. However, whether a dog is run in competition or used as a hunting companion, the basic training program is the same. top of page. Tallgrass Kennels is a gun dog kennel offering selectively bred British Labrador Retriever puppies, Started Pups & Started Dogs for sale. Breckland Gundog Training offer a service to source and train to your requirements, Labradors, Springers or Cocker Spaniels | Tel 07795 466007 Mar 31, 2025 · Gun Dogs for Sale - Finished Dogs. Marhystin Gundogs are based in Aberdeenshire, North East of Scotland. Each finished dog is imported from the UK. Training and stud dogs in kennel. GREAT SELECTION. Gun Dog Training Program. Premiere gun dog breeders of Labradors. We have over 30 years of experience in breeding and training to produce top quality gun dogs. Hunting lab breeders Labrador Retriever Puppies For Sale by Labrador Retriever Breeders, Trainers and Kennels Puppies for sale listings from the best gun dog breeders, trainers and kennels. We occasionally have trained dogs for sale. As American Labrador breeders, we raise purebred Labrador puppies & working Labrador puppies for sale. READY TO LEAVE NOW 28/3/2025 Silver Founded by Gary Hubbell and Doris Hubbell, OutWest Kennels has a long-standing legacy in quality gun dogs. Spell is a Finished Gun Dog. Just after graduating from the University of Colorado in 1985, Gary Hubbell started working with renowned trainer Mike Gould, whose Grand River line of Labrador retrievers were famous for their versatile abilities both in the upland field In recent years, the dog breeding landscape has been marred by distressing incidents, exacerbated by the challenges posed by COVID-19. With 57% of GunsOnPegs members owning dogs we offer the platform to buy and sell working gundogs and puppies. READY TO LEAVE NOW 28/3 Find Started Retrievers For Sale from across the United States. Our main emphasis at Deep Fork Retrievers is on training quality gun dogs. Connect with gun dog breeders and owners to find or sell trained hunting dogs. uk Mar 8, 2025 · Have a hunting dog for sale? List it here for Free. Here at Stagshead Gun Dogs we pride ourselves in producing good quality Pedigree health tested Labrador puppies for sale, plus the opportunity for others to use our health tested and well behaved Pedigree Labradors for stud duties. Sinead’s Introduction to Training. Duckhill Kennels continues the original model of breeding a sensitive tractable dog that equally excels as house dog or duck dog or upland dog. Three 8 month old started duck dogs for sale! These are premium quality Labrador Retrievers puppies that have been bred from outstanding duck dogs. Jul 7, 2020 · Have a hunting dog for sale? List it here for Free. These include the proliferation of backyard breeders, cases of dog theft, and the misuse of social media by unlicensed individuals posing as legitimate breeders. com. Buy & Sell Trained Gun Dogs Online with Gun Dog Trader - The UK's Fastest Growing Platform for the Buying and Selling of Trained Gun Dog Online Other Working Dogs Moccasin Creek Kennel strives to excel in breeding and training of quality Labrador Retrievers in Texas offering experienced UKC hunt test competition and gun dog training, excellent pedigreed stud dogs, trained Labrador Retrievers for sale in Texas and Labrador Puppies for sale in Texas. Wildrose has started labrador retrievers for sale and finished labrador retrievers for sale. Jeremy Hunt has written extensively about the breed and is the author of one of the most successful books on gundog training – “Training the Working Labrador – the Complete Guide to Management and Training. Posted on 11/04/2024 - The disposition of these dogs will make them as fine a family dog as they will be a hunting companion. Started Hunting Dog3. S. Also included Basic training advice is complementary from Cuckavalda. Connect with breeders and owners to find or sell trained hunting dogs. The Sporting Dog: Hard-charging dogs for the demanding sportsman and active outdoor family. Abe is a male black Labrador hunting dog for sale at Granite Ledge Kennels. Sporting Classics Magazine Blue Cypress Kennels has turned the retriever world upside down. The dogs will have experienced in excess of 20 days in the field and as part of the handover the new client will spend at least 2 days shooting and handling the new dog with our guidance and support. The started dogs have bee We provide first class professional gun dog training for your retriever, and world class Labrador Retriever puppies for hunting families. Sinead bought her first gundog (Fern- Dreamacres Wigeon Von Mekoro) in 2008 with a view to train up for the peg and to come out rough shooting. At SOK we are redefining what a Labrador gun dog looks like in America. This off-switch extends beyond napping in the kennel. 1 month ago. We sometimes have Labrador and cocker spaniel puppies and part trained dogs for sale. MALE - WHELPED ON 05/08/2021. Gundog Breeder and Trainer Paul Truby, Champion field trial winning gundog labradors. Jul 18, 2022 · We pride ourselves in in the highest quality British Labrador Retriever Puppies that exceed every clients expectations. Mar 10, 2025 · Hunting dogs are athletes and are sometimes much leaner than pet dogs of the same breeds. We offer professional retriever training for hunting and AKC hunting test and are breeders of top quality working labradors. ” TRAINED LABRADOR GUN DOGS FOR SALE AT GRANITE LEDGE KENNELS. 00. Started labs are 7 months old and have basic obedience training. Oxfordshire countryside professional gundog and labrador dog trainer. Simplifying the process of acquiring your perfect canine companion. Search by dog breed or by location to find the best possible match. yxrbfhsqtoiafxntulupahoasknypkcrcnsminfthdynfedmvkvemimelyqoxmqetprgiiidoyoyslld